Enter your keyword

Recombinant Sortase A protein(His tag)

30.1% New Hot

Recombinant Sortase A protein(His tag)

$895.00 $626.00

Compare
Compare
GS34628. In stock N/A , , . , , , .

Description

Sortase was the first member of a novel family of cell surface, membrane anchored transpeptidases identified from Staphylcoccus aureus. It is involved in the processing, presentation and attachment of key cell surface proteins such as protein A to the peptidoglycan of the bacterial cell wall. Inhibition of SrtA has resulted in reduced adhesive properties of this pathogen and represents a target for the development of novel anti-bacterials..

Source :Escherichia coli

Immunogen:

MHHHHHHKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKD KSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIA GHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGV LDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK.

Storage instructions: Shipped on Dry Ice. Store at -80℃. Avoid freeze / thaw cycle.

Concentration: 0.45 mg/ml

Purity: ≥87%

Tested applications:SDS-PAGE(27kDa including tag)