Description
The kit takes out from the refrigeration should be balanced 15-30 minutes in the room temperature, if the coated ELISA plates have not been used up after opening, the plate should be stored in sealed bag.
Washing buffer will Crystallization separation, it can be heated the water helps dissolve when dilution. Washing does not affect the result.
Pipette sample with pipettors each step, and proofread its accuracy frequently, avoids the experimental error. Pipette sample within 5 min, if the number of sample is much, recommend using multichannel pipettor.
If the testing material content is excessively high (The sample OD is higher than the first standard well)?please dilute sample (n-fold).
Adhesive Strip only limits the disposable use to avoid cross-contamination.
The substrate should be preserved evade the light.
Please refer to use instruction strictly. The test result determination must take the microtiter plate reader as a standard.
All samples, washing buffer and each kind of reject should refer to infective material process.
Do not mix reagents with those from other lots.
Reactivity : Pig
Method type : Sandwich ELISA
Minimum Detection Limit :
Detection Range :
Application : ELISA
Purpose : For the quantitative determination of target substances concentrations.
Research Area : Signal Transduction->Cytoskeleton / ECM->Cytoskeleton->Motor Proteins->Myosin
Sample Type : serum, plasma, Urine, tissue samples, cell culture supernates
Plate : Pre-coated,Strips (12 x 8)
Restrictions : For Research Use only
Storage : 2 °C - 8 °C
Storage Comment : Store at 4°C for 6 months, at -20°C for 12 months. Avoid multiple freeze-thaw cycles
Expiry Date : 12 months
Size : 96T
Uniprot No. :Q9TDR1
Abbreviation :
MNPFASLTLTTLIILTIPIMMSNSNIYKTNLYPNYVKTTVSYAFTLSLVPLLMFMHTGQE MIISNWHWMTLQTVELSLSFKMDYFSVMFIPVALFVTWSIMEFSMWYMHSDPFINRFFKY LVLFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWHGRTDANTAALQAILYNRIGDI GFVLSMAWFLTHSNAWDLQQIFMLNNECPNMPLIGLLLAAAGKSAQFGLHPWLPSAMEGP TPVSALLHSSTMVVAGVFLLIRFYPLMETNKLVQTMTLCLGAITTLFTALCAITQNDIKK IVAFSTSSQLGLMMVTIGINQPHLAFLHICMHAFFKAMLFMCSGSIIHSLNDEQDIRKMG GLYKAMPFTTTALIIGSLALTGMPYLTGFYSKDLIIEAVNMSYTNAWALLMTLIATSLTA AYSTRIIFFAFLGKPRFPPLVLINENNPLLINSIKRLLIGSIFAGFIISNNIPPMTVPNT TMPLYMKMTALIVTIMGFMLALELNNTTYYLKFKYPSQTYKFSNMLGYYPSIMHRLPTYH NLSMSQKSASSLLDLIWLETILPKTTSFIQMKMSIMVSNQKGLIKLYFLSFLITIMISMT LFNYHE
Availability : 3-5 working days
Target Details :Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Precision : Intra-assay Precision (Precision within an assay) CV%<15% Three samples of known concentration were tested twenty times on one plate to assess. Inter-assay Precision (Precision between assays) CV%<15% Three samples of known concentration were tested in twenty assays to assess.
Linearity : To assess the linearity of the assay, samples were spiked with hig3h concentrations of rat ADP in various matrices and diluted with the Sample Diluent to produce samples with values within the dynamic range of the assay.
Recovery :
Typical Data : These standard curves are provided for demonstration only. A standard curve should be generated for each set of samples assayed. ng/ml OD1 OD2 Average 1000 0.088 0.090 0.089 500 0.135 0.142 0.139 250 0.227 0.237 0.232 125 0.324 0.341 0.333 62.5 0.583 0.598 0.591 31.25 0.847 0.864 0.856 15.62 1.228 1.235 1.232 0 2.155 2.199 2.177