Description

The kit takes out from the refrigeration should be balanced 15-30 minutes in the room temperature, if the coated ELISA plates have not been used up after opening, the plate should be stored in sealed bag.
Washing buffer will Crystallization separation, it can be heated the water helps dissolve when dilution. Washing does not affect the result.
Pipette sample with pipettors each step, and proofread its accuracy frequently, avoids the experimental error. Pipette sample within 5 min, if the number of sample is much, recommend using multichannel pipettor.
If the testing material content is excessively high (The sample OD is higher than the first standard well)?please dilute sample (n-fold).
Adhesive Strip only limits the disposable use to avoid cross-contamination.
The substrate should be preserved evade the light.
Please refer to use instruction strictly. The test result determination must take the microtiter plate reader as a standard.
All samples, washing buffer and each kind of reject should refer to infective material process.
Do not mix reagents with those from other lots.

Reactivity : Rabbit

Method type : Sandwich ELISA

Minimum Detection Limit :

Detection Range :

Application : ELISA

Purpose : For the quantitative determination of target substances concentrations.

Research Area : Signal Transduction->Cytoskeleton / ECM->Cytoskeleton->Motor Proteins->Myosin

Sample Type : serum, plasma, Urine, tissue samples, cell culture supernates

Plate : Pre-coated,Strips (12 x 8)

Restrictions : For Research Use only

Storage : 2 °C - 8 °C

Storage Comment : Store at 4°C for 6 months, at -20°C for 12 months. Avoid multiple freeze-thaw cycles

Expiry Date : 12 months

Size : 96T

Uniprot No. :P03915

Abbreviation :Synthetic peptide corresponding to Human MT-ND5 aa 321-370.
Sequence:QPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMGGLLKTMPLTS.

Availability : 3-5 working days

Target Details :Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.Defects in MT-ND5 are a cause of Leber hereditary optic neuropathy (LHON) . LHON is a maternally inherited disease resulting in acute or subacute loss of central vision, due to optic nerve dysfunction. Cardiac conduction defects and neurological defects have also been described in some patients. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes.Defects in MT-ND5 are a cause of Leigh syndrome (LS) . LS is a severe neurological disorder characterized by bilaterally symmetrical necrotic lesions in subcortical brain regions.Defects in MT-ND5 are a cause of mitochondrial complex I deficiency (MT-C1D) . A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.Defects in MT-ND5 are a cause of mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS) . MELAS is a genetically heterogenious disorder, characterized by episodic vomiting, seizures, and recurrent cerebral insults resembling strokes and causing hemiparesis, hemianopsia, or cortical blindness.

Precision : Intra-assay Precision (Precision within an assay) CV%<15%   Three samples of known concentration were tested twenty times on one plate to assess.   Inter-assay Precision (Precision between assays) CV%<15%   Three samples of known concentration were tested in twenty assays to assess.

Linearity : To assess the linearity of the assay, samples were spiked with hig3h concentrations of rat ADP in various matrices and diluted with the Sample Diluent to produce samples with values within the dynamic range of the assay.

Recovery :

Typical Data : These standard curves are provided for demonstration only. A standard curve should be generated for each set of samples assayed. ng/ml OD1 OD2 Average     1000 0.088 0.090 0.089     500 0.135 0.142 0.139     250 0.227 0.237 0.232     125 0.324 0.341 0.333     62.5 0.583 0.598 0.591     31.25 0.847 0.864 0.856     15.62 1.228 1.235 1.232     0 2.155 2.199 2.177