Description

The kit takes out from the refrigeration should be balanced 15-30 minutes in the room temperature, if the coated ELISA plates have not been used up after opening, the plate should be stored in sealed bag.
Washing buffer will Crystallization separation, it can be heated the water helps dissolve when dilution. Washing does not affect the result.
Pipette sample with pipettors each step, and proofread its accuracy frequently, avoids the experimental error. Pipette sample within 5 min, if the number of sample is much, recommend using multichannel pipettor.
If the testing material content is excessively high (The sample OD is higher than the first standard well)?please dilute sample (n-fold).
Adhesive Strip only limits the disposable use to avoid cross-contamination.
The substrate should be preserved evade the light.
Please refer to use instruction strictly. The test result determination must take the microtiter plate reader as a standard.
All samples, washing buffer and each kind of reject should refer to infective material process.
Do not mix reagents with those from other lots.

Reactivity : Chicken

Method type : Sandwich ELISA

Minimum Detection Limit :

Detection Range :

Application : ELISA

Purpose : For the quantitative determination of target substances concentrations.

Research Area : Immunology->Innate Immunity->Complement->Alternative Pathway, Immunology->Innate Immunity->Complement->Other

Sample Type : serum, plasma, Urine, tissue samples, cell culture supernates

Plate : Pre-coated,Strips (12 x 8)

Restrictions : For Research Use only

Storage : 2 °C - 8 °C

Storage Comment : Store at 4°C for 6 months, at -20°C for 12 months. Avoid multiple freeze-thaw cycles

Expiry Date : 12 months

Size : 96T

Uniprot No. :Q5ZLD7

Abbreviation :

MEEDELELAAGLEAALELAPAVQAAIEQVFPSQDPLDRADFNAVEYINTLFPTEQSLANI
DEVVNKIRLKIRKLDDNIRTVVRGQTNVGQDGRQALEEAQKAIQQLFGKIKDIKDKAEKS
EQMVKEITRDIKQLDHAKRHLTTSITTLNHLHMLAGGVDSLEAMTRRRQYGEVANLLQGV
VNVLEHFNKYMGIPQIRQLSERVKAAQNELGQQILADFEEAFPSQGTKRPGGPSNVLRDA
CLVANVLDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAWLDKIDRRYAWIKRQLVDYEEK
YGRMFPQEWCMTERIAVEFCHVTRTELAKIMRTRAKEIEVKLLLFAIQRTTNFEGLLAKR
FSGCTLADGTVKKPEAPPPSTNPFLEDETGTETDEIVIEKSDADKPKKPKVPDNPFHGIV
SKCFEPHLYVYIESQDKNLSELIDRFVADFKAQGPPKPNVDEGGAVLPSCADLFVYYKKC
MVQCSQLSTGEPMIALTTIFQKYLREYAWKILSGNLPKTTSSSGGLTITSLLKEKEGSEV
AKFTLEELCLICSILSTAEYCLATTQQLEEKLKEKVDASLVERINLTGETDTFSIVISNS
IQLLVQDLDAACDPALTAMSKMQWQNVEHVGDQSPYVTSVILHIKQNVPIIRDNLASTRK
YFTQFCIKFANSFIPKFINHLFKCKPISMVGAEQLLLDTHSLKMVLLDLPSIGSQVVRKA
PASYTRIVVKGMTRAEMILKVVMAPHEPPVVFVDNYIKLLADCSTDTFQKILDMKGLKRS
EQSSMLELFRQRLPAPPSGVENSGSLSLSAPTPEQESSRIRKLEKLIKKRL

Availability : 3-5 working days

Target Details :Acts as component of the GARP complex that is involved in retrograde transport from early and late endosomes to the trans-Golgi network (TGN). Acts as component of the EARP complex that is involved in endocytic recycling.

Precision : Intra-assay Precision (Precision within an assay) CV%<15%   Three samples of known concentration were tested twenty times on one plate to assess.   Inter-assay Precision (Precision between assays) CV%<15%   Three samples of known concentration were tested in twenty assays to assess.

Linearity : To assess the linearity of the assay, samples were spiked with hig3h concentrations of rat ADP in various matrices and diluted with the Sample Diluent to produce samples with values within the dynamic range of the assay.

Recovery :

Typical Data : These standard curves are provided for demonstration only. A standard curve should be generated for each set of samples assayed. ng/ml OD1 OD2 Average     1000 0.088 0.090 0.089     500 0.135 0.142 0.139     250 0.227 0.237 0.232     125 0.324 0.341 0.333     62.5 0.583 0.598 0.591     31.25 0.847 0.864 0.856     15.62 1.228 1.235 1.232     0 2.155 2.199 2.177